UBE2C Rabbit Polyclonal Antibody

CAT#: TA331549

Rabbit Polyclonal Anti-UBE2C Antibody

Product Images

WB Suggested Anti-UBE2C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UBE2C Antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: ubiquitin conjugating enzyme E2 C
• Database Link:
  NP_861515
  Entrez Gene 11065 Human
  UniProt ID O00762
• Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.
• Synonyms: dJ447F3.2; UBCH10
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis