UBE2L6 (NM_198183) Human Recombinant Protein
CAT#: TP720968
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPSLEHHHHHH
|
Tag | C-His |
Predicted MW | 18.8 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_937826 |
Locus ID | 9246 |
UniProt ID | O14933 |
Cytogenetics | 11q12.1 |
Refseq Size | 1642 |
Refseq ORF | 462 |
Synonyms | RIG-B; UBCH8 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Protein Pathways | Parkinson's disease, Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401353 | UBE2L6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC404883 | UBE2L6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401353 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 1 |
USD 325.00 |
|
LY404883 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2 |
USD 325.00 |
|
PH307106 | UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_937826) |
USD 2,055.00 |
|
PH312405 | UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_004214) |
USD 2,055.00 |
|
TP307106 | Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2 |
USD 823.00 |
|
TP312405 | Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review