UBE2L6 (NM_004223) Human Mass Spec Standard

CAT#: PH312405

UBE2L6 MS Standard C13 and N15-labeled recombinant protein (NP_004214)

Product Images

Coomassie blue staining of purified UBE2L6 protein (Cat# TP312405). The protein was produced from HEK293T cells transfected with UBE2L6 cDNA clone (Cat# RC212405) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212405
• Predicted MW: 17.6 kDa
• Protein Sequence:
  Sequence Link

  >RC212405 representing NM_004223
  Red=Cloning site Green=Tags(s)
  
  MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF
  TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA
  EEFTLRFGVDRPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004214
• RefSeq Size: 1260
• RefSeq ORF: 459
• Synonyms: RIG-B; UBCH8
• Locus ID: 9246
• UniProt ID: O14933
• Cytogenetics: 11q12.1
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2011]
• Protein Pathways: Parkinson's disease, Ubiquitin mediated proteolysis