Alpha Taxilin (TXLNA) (NM_175852) Human Recombinant Protein

CAT#: TP720978

Purified recombinant protein of Human taxilin alpha (TXLNA)

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH
• Tag: N, C-HIS
• Predicted MW: 20.4 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_787048
• Locus ID: 200081
• UniProt ID: P40222
• Cytogenetics: 1p35.2
• Refseq Size: 4843
• Refseq ORF: 1638
• Synonyms: IL14; TXLN
• Summary: May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome