CD16b (FCGR3B) (NM_000570) Human Recombinant Protein

CAT#: TP721068

Purified recombinant protein of Human Fc fragment of IgG, low affinity IIIb, receptor (CD16b) (FCGR3B)


USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "FCGR3B"

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Tag C-Fc/His
Predicted MW 49.3 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000561
Locus ID 2215
UniProt ID O75015, A0A3B3ISU3
Cytogenetics 1q23.3
Refseq Size 2148
Refseq ORF 699
Synonyms CD16; CD16A; CD16b; FCG3; FCGR3; FCGR3A; FCR-10; FCRIII; FCRIIIb
Summary 'The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1. [provided by RefSeq, Aug 2012]'
Protein Families ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity, Systemic lupus erythematosus

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.