HEPC (HAMP) (NM_021175) Human Recombinant Protein
CAT#: TP721154
Purified recombinant protein of Human hepcidin antimicrobial peptide (HAMP)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCG
|
Tag | N-GST |
Predicted MW | 2.92 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_066998 |
Locus ID | 57817 |
UniProt ID | P81172 |
Cytogenetics | 19q13.12 |
Refseq Size | 430 |
Refseq ORF | 252 |
Synonyms | HEPC; HFE2B; LEAP1; PLTR |
Summary | The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402850 | HAMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402850 | Transient overexpression lysate of hepcidin antimicrobial peptide (HAMP) |
USD 325.00 |
|
PH304620 | HAMP MS Standard C13 and N15-labeled recombinant protein (NP_066998) |
USD 2,055.00 |
|
TP304620 | Recombinant protein of human hepcidin antimicrobial peptide (HAMP) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review