HEPC (HAMP) (NM_021175) Human Recombinant Protein

CAT#: TP304620

Recombinant protein of human hepcidin antimicrobial peptide (HAMP)

Product Images

Coomassie blue staining of purified HAMP protein (Cat# TP304620). The protein was produced from HEK293T cells transfected with HAMP cDNA clone (Cat# RC204620) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204620 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCC
  GCCHRSKCGMCCKT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 6.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066998
• Locus ID: 57817
• UniProt ID: P81172
• Cytogenetics: 19q13.12
• Refseq Size: 430
• Refseq ORF: 252
• Synonyms: HEPC; HFE2B; LEAP1; PLTR
• Summary: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein, Transmembrane