Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HAMP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAMP antibody: synthetic peptide directed towards the N terminal of human HAMP. Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM |
HEPC (HAMP) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 24~54 amino acids from the Central region of Human Hepcidin / HAMP |
Rabbit polyclonal anti Hepcidin-25 (ms); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Thr-Asn-Phe-Pro-Ile-Cys-Leu-Phe-Cys-Cys- Lys-Cys-Cys-Lys-Asn-Ser-Ser-Cys-Gly-Leu-Cys-Cys-Ile-Thr-OH coupled to carrier protein. |
HAMP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HAMP |
Active filters
Target Symbol
- HAMP