ITLN1 (NM_017625) Human Recombinant Protein

CAT#: TP721171

Purified recombinant protein of Human intelectin 1 (galactofuranose binding) (ITLN1)

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MNHKVHHHHHHMTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNT
• Tag: N-His
• Predicted MW: 32.7 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 50mM Tris,100mMNaCl, 5mM GSH, 0.5mM GSSG,pH8.0
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060095
• Locus ID: 55600
• UniProt ID: Q8WWA0
• Cytogenetics: 1q23.3
• Refseq Size: 1209
• Refseq ORF: 939
• Synonyms: hIntL; HL-1; HL1; INTL; ITLN; LFR; omentin
• Protein Families: Druggable Genome, Secreted Protein