PTPRN (NM_002846) Human Recombinant Protein
CAT#: TP721211
Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMRQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
|
Tag | N-His |
Predicted MW | 44.6 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris,150mM NaCl,pH8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002837 |
Locus ID | 5798 |
UniProt ID | Q16849, Q96IA0 |
Cytogenetics | 2q35 |
Refseq Size | 3649 |
Refseq ORF | 2937 |
Synonyms | IA-2; IA-2/PTP; IA2; ICA512; R-PTP-N |
Summary | 'The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Dec 2010]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419074 | PTPRN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY419074 | Transient overexpression lysate of protein tyrosine phosphatase, receptor type, N (PTPRN) |
USD 495.00 |
|
TP710233 | Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 insect cells |
USD 425.00 |
|
TP710234 | Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1, residues 35-575aa, with C-terminal DDK tag, expressed in sf9 insect cells |
USD 425.00 |
|
TP721209 | Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1 |
USD 300.00 |
|
TP721213 | Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review