PTPRN (NM_002846) Human Recombinant Protein

CAT#: TP721211

Purified recombinant protein of Human protein tyrosine phosphatase, receptor type, N (PTPRN), transcript variant 1


  View other "PTPRN" proteins (6)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "PTPRN"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGSSHHHHHHSSGLVPRGSHMRQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
Tag N-His
Predicted MW 44.6 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of 20mM Tris,150mM NaCl,pH8.0
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_002837
Locus ID 5798
UniProt ID Q16849, Q96IA0
Cytogenetics 2q35
Refseq Size 3649
Refseq ORF 2937
Synonyms IA-2; IA-2/PTP; IA2; ICA512; R-PTP-N
Summary 'The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single catalytic domain, and thus represents a receptor-type PTP. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Dec 2010]'
Protein Families Druggable Genome, Transmembrane
Protein Pathways Type I diabetes mellitus

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.