Apolipoprotein E (APOE) (NM_000041) Human Recombinant Protein
CAT#: TP721217
Purified recombinant protein of Human apolipoprotein E (APOE)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH
|
Tag | C-His |
Predicted MW | 35.3 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000032 |
Locus ID | 348 |
UniProt ID | P02649, A0A0S2Z3D5 |
Cytogenetics | 19q13.32 |
Refseq Size | 1223 |
Refseq ORF | 951 |
Synonyms | AD2; APO-E; ApoE4; LDLCQ5; LPG |
Summary | 'The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. [provided by RefSeq, Jun 2016]' |
Protein Families | Adult stem cells, Druggable Genome, Secreted Protein, Stem cell - Pluripotency |
Protein Pathways | Alzheimer's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424959 | APOE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424959 | Transient overexpression lysate of apolipoprotein E (APOE) |
USD 325.00 |
|
PH300395 | APOE MS Standard C13 and N15-labeled recombinant protein (NP_000032) |
USD 2,055.00 |
|
TP300395 | Recombinant protein of human apolipoprotein E (APOE) |
USD 823.00 |
|
TP723015 | Purified recombinant protein of Human apolipoprotein E (APOE). |
USD 140.00 |
|
TP723016 | Purified recombinant protein of Human apolipoprotein E (APOE). |
USD 140.00 |
{0} Product Review(s)
Be the first one to submit a review