CCDC134 (NM_024821) Human Recombinant Protein
CAT#: TP721226
Purified recombinant protein of Human coiled-coil domain containing 134 (CCDC134)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELVDHHHHHH
|
Tag | C-His |
Predicted MW | 25.3 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl, pH7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079097 |
Locus ID | 79879 |
UniProt ID | Q9H6E4 |
Cytogenetics | 22q13.2 |
Refseq Size | 1279 |
Refseq ORF | 687 |
Synonyms | dJ821D11.3 |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411042 | CCDC134 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411042 | Transient overexpression lysate of coiled-coil domain containing 134 (CCDC134) |
USD 325.00 |
|
PH304377 | CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097) |
USD 2,055.00 |
|
TP304377 | Recombinant protein of human coiled-coil domain containing 134 (CCDC134) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review