Inhibin beta B (INHBB) (NM_002193) Human Recombinant Protein
CAT#: TP723005
Purified recombinant protein of Human inhibin, beta B (INHBB).
Other products for "INHBB"
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
|
Tag | Tag Free |
Predicted MW | 25.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 was determined by its ability to inhibit the proliferation of murine MPC-11 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002184 |
Locus ID | 3625 |
UniProt ID | P09529 |
Cytogenetics | 2q14.2 |
Refseq Size | 3218 |
Refseq ORF | 1221 |
Synonyms | MGC157939 |
Summary | 'This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. Polymorphisms near this gene are associated with pre-eclampsia in female human patients. [provided by RefSeq, Aug 2016]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.