Angiopoietin 2 (ANGPT2) (NM_001147) Human Recombinant Protein
CAT#: TP723012
Purified recombinant protein of Human angiopoietin 2 (ANGPT2), transcript variant 1.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH
|
Tag | C-His |
Predicted MW | 56.95 |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2ug/mL |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001138 |
Locus ID | 285 |
UniProt ID | O15123 |
Cytogenetics | 8p23.1 |
Refseq Size | 2269 |
Refseq ORF | 1488 |
Synonyms | AGPT2; ANG2 |
Summary | 'This gene belongs to the angiopoietin family of growth factors. The protein encoded by this gene is an antagonist of angiopoietin 1, and both angiopoietin 1 and angiopoietin 2 are ligands for the endothelial TEK receptor tyrosine kinase. Angiopoietin 2 is upregulated in multiple inflammatory diseases and is implicated in the direct control of inflammation-related signaling pathways. The encoded protein affects angiogenesis during embryogenesis and tumorigenesis, disrupts the vascular remodeling ability of angiopoietin 1, and may induce endothelial cell apoptosis. This gene serves a prognostic biomarker for acute respiratory distress syndrome. [provided by RefSeq, Aug 2020]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400459 | ANGPT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC426530 | ANGPT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400459 | Transient overexpression lysate of angiopoietin 2 (ANGPT2), transcript variant 1 |
USD 495.00 |
|
LY426530 | Transient overexpression lysate of angiopoietin 2 (ANGPT2), transcript variant 3 |
USD 325.00 |
{0} Product Review(s)
Be the first one to submit a review