Apolipoprotein A I (APOA1) (NM_000039) Human Recombinant Protein
CAT#: TP723014
Purified recombinant protein of Human apolipoprotein A-I (APOA1).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
|
Tag | Tag Free |
Predicted MW | 28.2 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000030 |
Locus ID | 335 |
UniProt ID | P02647, A0A024R3E3 |
Cytogenetics | 11q23.3 |
Refseq Size | 897 |
Refseq ORF | 801 |
Synonyms | apo(a); HPALP2 |
Summary | 'This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400009 | APOA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400009 | Transient overexpression lysate of apolipoprotein A-I (APOA1) |
USD 325.00 |
|
PH310762 | APOA1 MS Standard C13 and N15-labeled recombinant protein (NP_000030) |
USD 2,055.00 |
|
TP310762 | Recombinant protein of human apolipoprotein A-I (APOA1) |
USD 823.00 |
|
TP720424 | Recombinant protein of human apolipoprotein A-I (APOA1) |
USD 300.00 |
|
TP721184 | Purified recombinant protein of Human apolipoprotein A-I (APOA1) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review