BDNF (NM_170734) Human Recombinant Protein
CAT#: TP723035
Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 6.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
|
| Tag | Tag Free |
| Predicted MW | 27 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 for this effect is 0.5-1.0ug/mL. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_733930 |
| Locus ID | 627 |
| UniProt ID | P23560 |
| Cytogenetics | 11p14.1 |
| Refseq Size | 3958 |
| Refseq ORF | 786 |
| Synonyms | ANON2; BULN2 |
| Summary | 'This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015]' |
| Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Transmembrane |
| Protein Pathways | Huntington's disease, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400640 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC403526 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC403537 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC406735 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC406736 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC406855 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428351 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428352 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428353 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428354 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428355 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428357 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428358 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428359 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428360 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428362 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430314 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400640 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 4 |
USD 436.00 |
|
| LY403526 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 6 |
USD 436.00 |
|
| LY403537 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 3 |
USD 436.00 |
|
| LY406735 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 2 |
USD 436.00 |
|
| LY406736 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 5 |
USD 436.00 |
|
| LY406855 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 1 |
USD 436.00 |
|
| LY428351 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 7 |
USD 436.00 |
|
| LY428352 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 8 |
USD 436.00 |
|
| LY428353 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 9 |
USD 436.00 |
|
| LY428354 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 10 |
USD 436.00 |
|
| LY428355 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 17 |
USD 436.00 |
|
| LY428357 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 11 |
USD 436.00 |
|
| LY428358 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 12 |
USD 436.00 |
|
| LY428359 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 13 |
USD 436.00 |
|
| LY428360 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 14 |
USD 436.00 |
|
| LY428362 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 16 |
USD 436.00 |
|
| LY430314 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 2 |
USD 396.00 |
|
| PH317124 | BDNF MS Standard C13 and N15-labeled recombinant protein (NP_733930) |
USD 2,055.00 |
|
| TP317124 | Recombinant protein of human brain-derived neurotrophic factor (BDNF), transcript variant 6 |
USD 748.00 |
|
| TP720589 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 |
USD 330.00 |
|
| TP720590 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China