CXCL14 (NM_004887) Human Recombinant Protein
CAT#: TP723048
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
|
Tag | Tag Free |
Predicted MW | 9.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by it's ability to chemoattract activated monocytes using a concentration range of 1.0-10.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004878 |
Locus ID | 9547 |
UniProt ID | O95715 |
Cytogenetics | 5q31.1 |
Refseq Size | 1989 |
Refseq ORF | 333 |
Synonyms | BMAC; BRAK; KEC; KS1; MIP-2g; MIP2G; NJAC; SCYB14 |
Summary | This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401525 | CXCL14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401525 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 14 (CXCL14) |
USD 325.00 |
|
TP720047 | Recombinant protein of human chemokine (C-X-C motif) ligand 14 (CXCL14) |
USD 300.00 |
|
TP723855 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14 / BRAK) |
USD 205.00 |
|
TP761185 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 14 (CXCL14), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review