CCN2 (NM_001901) Human Recombinant Protein

CAT#: TP723060

Purified recombinant protein of Human connective tissue growth factor (CTGF).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
• Tag: Tag Free
• Predicted MW: 11 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 ug/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001892
• Locus ID: 1490
• UniProt ID: P29279, Q5M8T4
• Cytogenetics: 6q23.2
• Refseq Size: 2358
• Refseq ORF: 1047
• Synonyms: CTGF; HCS24; IGFBP8; NOV2
• Summary: 'The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis. [provided by RefSeq, Nov 2009]'
• Protein Families: Druggable Genome, Secreted Protein