CXCL16 (NM_022059) Human Recombinant Protein

CAT#: TP723062

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 16 (CXCL16), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLP
• Tag: Tag Free
• Predicted MW: 10.1 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by it's ability to chemoattract activated lymphocytes using a concentration of 1.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071342
• Locus ID: 58191
• UniProt ID: Q9H2A7
• Cytogenetics: 17p13.2
• Refseq Size: 2343
• Refseq ORF: 819
• Synonyms: CXCLG16; SR-PSOX; SRPSOX
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction