CXCL16 (NM_022059) Human Recombinant Protein
CAT#: TP723062
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 16 (CXCL16), transcript variant 1.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLP
|
Tag | Tag Free |
Predicted MW | 10.1 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by it's ability to chemoattract activated lymphocytes using a concentration of 1.0-100.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071342 |
Locus ID | 58191 |
UniProt ID | Q9H2A7 |
Cytogenetics | 17p13.2 |
Refseq Size | 2343 |
Refseq ORF | 819 |
Synonyms | CXCLG16; SR-PSOX; SRPSOX |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411807 | CXCL16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420290 | CXCL16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426126 | CXCL16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411807 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 16 (CXCL16), transcript variant 1 |
USD 325.00 |
|
LY420290 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 16 (CXCL16), transcript variant 2 |
USD 325.00 |
|
LY426126 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 16 (CXCL16), transcript variant 2 |
USD 325.00 |
|
TP723866 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 16 (CXCL16), transcript variant 2 |
USD 190.00 |
{0} Product Review(s)
Be the first one to submit a review