Ccl11 (NM_011330) Mouse Recombinant Protein

CAT#: TP723080

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 11 (Ccl11).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
• Tag: Tag Free
• Predicted MW: 8.4 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Murine Eotaxin was found to induce chemotaxis of purified eosinophils at concentrations ranging between 100-1000 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_035460
• Locus ID: 20292
• UniProt ID: P48298
• Cytogenetics: 11 49.84 cM
• Refseq Size: 1073
• Refseq ORF: 294
• Synonyms: eotaxin; Scya11
• Summary: In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils. [UniProtKB/Swiss-Prot Function]