EREG (NM_001432) Human Recombinant Protein

CAT#: TP723085

Purified recombinant protein of Human epiregulin (EREG).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
• Tag: Tag Free
• Predicted MW: 5.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001423
• Locus ID: 2069
• UniProt ID: O14944
• Cytogenetics: 4q13.3
• Refseq Size: 4627
• Refseq ORF: 507
• Synonyms: Ep; EPR; ER
• Summary: 'This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4 (ERBB4). The encoded protein may be involved in a wide range of biological processes including inflammation, wound healing, oocyte maturation, and cell proliferation. Additionally, the encoded protein may promote the progression of cancers of various human tissues. [provided by RefSeq, Jul 2015]'
• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: ErbB signaling pathway