CD62E (SELE) (NM_000450) Human Recombinant Protein
CAT#: TP723086
Purified recombinant protein of Human selectin E (SELE).
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | CHO |
| Expression cDNA Clone or AA Sequence |
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP
|
| Tag | Tag Free |
| Predicted MW | 58.6 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Measured by its ability to support adhesion of U937 cells, a human hystiocytic lymphoma cell line. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000441 |
| Locus ID | 6401 |
| UniProt ID | P16581 |
| Cytogenetics | 1q24.2 |
| Refseq Size | 3834 |
| Refseq ORF | 1830 |
| Synonyms | CD62E; ELAM; ELAM1; ESEL; LECAM2 |
| Summary | 'The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400158 | SELE HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400158 | Transient overexpression lysate of selectin E (SELE) |
USD 665.00 |
|
| PH321153 | SELE MS Standard C13 and N15-labeled recombinant protein (NP_000441) |
USD 2,055.00 |
|
| TP321153 | Recombinant protein of human selectin E (SELE) |
USD 788.00 |
|
| TP721057 | Purified recombinant protein of Human selectin E (SELE) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China