FGF21 (NM_019113) Human Recombinant Protein

CAT#: TP723096

Purified recombinant protein of Human fibroblast growth factor 21 (FGF21).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
• Tag: Tag Free
• Predicted MW: 19.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >90% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061986
• Locus ID: 26291
• UniProt ID: Q9NSA1
• Cytogenetics: 19q13.33
• Refseq Size: 940
• Refseq ORF: 627
• Synonyms: fibroblast growth factor 21
• Summary: Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue. [provided by RefSeq, Mar 2016]
• Protein Families: Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton