Fgf2 (NM_019305) Rat Recombinant Protein

CAT#: TP723108

Purified recombinant protein of Rat fibroblast growth factor 2 (Fgf2).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Tag: Tag Free
• Predicted MW: 16.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells is less than or equal to 0.2 ng/ml corresponding to a specific activity of >5 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_062178
• Locus ID: 54250
• UniProt ID: P13109
• Cytogenetics: 2q25
• Refseq Size: 1016
• Refseq ORF: 462
• Synonyms: bFGF; Fgf-2
• Summary: activates the MAP kinase signaling pathway; plays a role in synaptic transmission; induces cell proliferation [RGD, Feb 2006]