GDF15 (NM_004864) Human Recombinant Protein

CAT#: TP723131

Purified recombinant protein of Human growth differentiation factor 15 (GDF15).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: CHO
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
• Tag: Tag Free
• Predicted MW: 12 kDa
• Concentration: Centrifuge the vial prior to opening. Reconstitute the protein in water to a concnetration of 0.1 ~ 1.0 mg/ml. Do not vertex. For extended storage, it is recommended to further dilute in a proper buffer containing a carrier protein such as 0.1% BSA, and store in working aliquots at -20°C or -80°C
• Purity: ≥ 95% by SDS-PAGE gel and HPLC analyses
• Buffer: Lyophilized from a 0.2 µM filtered solution of 10mM Sodium Citrate, pH3.0
• Bioactivity: Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osteoblastcells. The expected ED50 for this effect is 75-200 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004855
• Locus ID: 9518
• UniProt ID: Q99988
• Cytogenetics: 19p13.11
• Refseq Size: 1220
• Refseq ORF: 924
• Synonyms: GDF-15; MIC-1; MIC1; NAG-1; PDF; PLAB; PTGFB
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Secreted Protein