Gdnf (NM_019139) Rat Recombinant Protein

CAT#: TP723139

Purified recombinant protein of Rat glial cell derived neurotrophic factor (Gdnf).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI
• Tag: Tag Free
• Predicted MW: 15 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to stimulate the proliferation of rat C6 cells.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_062012
• Locus ID: 25453
• UniProt ID: Q07731, A7UGJ1
• Cytogenetics: 2q16
• Refseq Size: 700
• Refseq ORF: 633
• Synonyms: gndf
• Summary: neurotrophic factor specific for midbrain dopamine neurons; binds to GDNFR-alpha and mediates activation of the Ret protein tyrosine kinase receptor [RGD, Feb 2006]