HB EGF (HBEGF) (NM_001945) Human Recombinant Protein

CAT#: TP723152

Purified recombinant protein of Human heparin-binding EGF-like growth factor (HBEGF).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
• Tag: Tag Free
• Predicted MW: 9.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is less than or equal to 1.0 ng/ml, corresponding to a specific activity of >1 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001936
• Locus ID: 1839
• UniProt ID: Q99075
• Cytogenetics: 5q31.3
• Refseq Size: 2381
• Refseq ORF: 624
• Synonyms: DTR; DTS; DTSF; HEGFL
• Summary: ''
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, GnRH signaling pathway