ICAM1 (NM_000201) Human Recombinant Protein
CAT#: TP723160
Purified recombinant protein of Human intercellular adhesion molecule 1 (ICAM1).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
|
Tag | Tag Free |
Predicted MW | 49.5 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ICAM-1 supported the adhesion of more than 50% PMA-stimulated HSB2 cells to plates coated at 25ug/mL ICAM-1 concentration. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000192 |
Locus ID | 3383 |
UniProt ID | P05362, A0A384MEK5 |
Cytogenetics | 19p13.2 |
Refseq Size | 2986 |
Refseq ORF | 1596 |
Synonyms | BB2; CD54; P3.58 |
Summary | 'This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Viral myocarditis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400073 | ICAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400073 | Transient overexpression lysate of intercellular adhesion molecule 1 (ICAM1) |
USD 325.00 |
|
PH300714 | ICAM1 MS Standard C13 and N15-labeled recombinant protein (NP_000192) |
USD 2,055.00 |
|
TP300714 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 1 (ICAM1) |
USD 823.00 |
|
TP720283 | Recombinant protein of human intercellular adhesion molecule 1 (ICAM1) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review