Interferon beta (IFNB1) (NM_002176) Human Recombinant Protein

CAT#: TP723161

Purified recombinant protein of Human interferon, beta 1, fibroblast (IFNB1).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: CHO
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Tag: Tag Free
• Predicted MW: 20 kDa
• Concentration: Centrifuge the vial prior to opening. Reconstitute the protein in water to a concnetration of 0.1 ~ 1.0 mg/ml. Do not vertex. For extended storage, it is recommended to further dilute in a proper buffer (i.e. water or PBS) containing a carrier protein such as 0.1% BSA, and store in working aliquots at -20°C or -80°C
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay #1:Measured by its ability to induce apoptosis in HeLa cells. The expected ED50 for this effect is 20-30 ng/ml. Assay #2:Determined by its ability to stimulate the proliferation of human TF-1 cells. The expected ED50 is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002167
• Locus ID: 3456
• UniProt ID: P01574
• Cytogenetics: 9p21.3
• Refseq Size: 840
• Refseq ORF: 561
• Synonyms: IFB; IFF; IFN-beta; IFNB
• Summary: 'This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection. [provided by RefSeq, Sep 2015]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway