Ifng (NM_008337) Mouse Recombinant Protein

CAT#: TP723163

Purified recombinant protein of Mouse interferon gamma (Ifng).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
• Tag: Tag Free
• Predicted MW: 15.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is less than or equal to 0.2 ng/ml, corresponding to a specific activity of > 5 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032363
• Locus ID: 15978
• UniProt ID: P01580
• Cytogenetics: 10 66.75 cM
• Refseq Size: 1207
• Refseq ORF: 465
• Synonyms: Ifg; IFN-g
• Summary: This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mice deficient in this gene have increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]