Ifng (NM_138880) Rat Recombinant Protein
CAT#: TP723164
Purified recombinant protein of Rat interferon gamma (Ifng).
Other products for "Ifng"
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
|
Tag | Tag Free |
Predicted MW | 15.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by a cytopathic affect inhibition assay with murine L929 cells challenged with EMC virus was < 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620235 |
Locus ID | 25712 |
UniProt ID | P01581 |
Cytogenetics | 7q22 |
Refseq Size | 525 |
Refseq ORF | 468 |
Synonyms | IFNG2 |
Summary | an immune molecule produced by T lymphocytes in response to mitogens or antigens [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.