Ifng (NM_138880) Rat Recombinant Protein

CAT#: TP723164

Purified recombinant protein of Rat interferon gamma (Ifng).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
• Tag: Tag Free
• Predicted MW: 15.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 as determined by a cytopathic affect inhibition assay with murine L929 cells challenged with EMC virus was < 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620235
• Locus ID: 25712
• UniProt ID: P01581
• Cytogenetics: 7q22
• Refseq Size: 525
• Refseq ORF: 468
• Synonyms: IFNG2
• Summary: an immune molecule produced by T lymphocytes in response to mitogens or antigens [RGD, Feb 2006]