IL12B (NM_002187) Human Recombinant Protein
CAT#: TP723187
Purified recombinant protein of Human interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
p40subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
|
Tag | Tag Free |
Predicted MW | 80 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002178 |
Locus ID | 3593 |
UniProt ID | P29460 |
Cytogenetics | 5q33.3 |
Refseq Size | 2347 |
Refseq ORF | 984 |
Synonyms | CLMF; CLMF2; IL-12B; IMD28; IMD29; NKSF; NKSF2 |
Summary | 'This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Allograft rejection, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400792 | IL12B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400792 | Transient overexpression lysate of interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B) |
USD 325.00 |
|
PH309679 | IL12B MS Standard C13 and N15-labeled recombinant protein (NP_002178) |
USD 2,055.00 |
|
TP309679 | Recombinant protein of human interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B) |
USD 823.00 |
|
TP710014 | Recombinant protein of human interleukin 12B (natural killer cell stimulatory factor 2, p40) (IL12B), full length, with C-terminal DDK,expressed in sf9 cells |
USD 425.00 |
|
TP723186 | Purified recombinant protein of Human interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review