IL1 beta (IL1B) (NM_000576) Human Recombinant Protein
CAT#: TP723210
Purified recombinant protein of Human interleukin 1, beta (IL1B).
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
|
| Tag | Tag Free |
| Predicted MW | 17.3 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | ED50 as determined by the dose-dependent stimulation of thymidine uptake by murine D10S cells is less than or equal to 1.0 pg/ml, corresponding to a specific activity of > 1 x 10^9 units/mg. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000567 |
| Locus ID | 3553 |
| UniProt ID | P01584 |
| Cytogenetics | 2q14.1 |
| Refseq Size | 1498 |
| Refseq ORF | 807 |
| Synonyms | IL-1; IL1-BETA; IL1beta; IL1F2 |
| Summary | 'The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Similarly, IL-1B has been implicated in human osteoarthritis pathogenesis. Patients with severe Coronavirus Disease 2019 (COVID-19) present elevated levels of pro-inflammatory cytokines such as IL-1B in bronchial alveolar lavage fluid samples. The lung damage induced by the Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL-1B. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2020]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Alzheimer's disease, Apoptosis, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, MAPK signaling pathway, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway, Type I diabetes mellitus |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400196 | IL1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400196 | Transient overexpression lysate of interleukin 1, beta (IL1B) |
USD 436.00 |
|
| PH302079 | IL1B MS Standard C13 and N15-labeled recombinant protein (NP_000567) |
USD 2,055.00 |
|
| TP302079 | Recombinant protein of human interleukin 1, beta (IL1B) |
USD 823.00 |
|
| TP721027 | Purified recombinant protein of Human interleukin 1, beta (IL1B) |
USD 330.00 |
|
| TP721175 | Purified recombinant protein of Human interleukin 1, beta (IL1B) |
USD 330.00 |
|
| TP723772 | Purified recombinant protein of Human interleukin 1, beta (IL1B) |
USD 255.00 |
|
| TP750014 | Recombinant protein of human IL 1 beta (IL1B) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China