Il21 (NM_021782) Mouse Recombinant Protein

CAT#: TP723218

Purified recombinant protein of Mouse interleukin 21 (Il21).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
• Tag: Tag Free
• Predicted MW: 15 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Measured by its ability to increase proliferation in mouse splenocytes induced by anti-hCD40 mAb. The expected ED50 is 15-20 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068554
• Locus ID: 60505
• UniProt ID: Q9ES17, Q5SUE2
• Cytogenetics: 3 B
• Refseq Size: 3090
• Refseq ORF: 441
• Synonyms: IL-21