Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IL-21 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor . |
Rabbit polyclonal anti-IL21 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IL21. |
Anti-Murine IL-21 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-21 |
Mouse Polyclonal IL-21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full-length human IL-21 |
Rabbit Polyclonal Anti-IL21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS |
IL21 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IL21