IL21 Rabbit Polyclonal Antibody

CAT#: TA343043

Rabbit Polyclonal Anti-IL21 Antibody

Product Images

Host: Rabbit; Target Name: IL21; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL21 antibody is: synthetic peptide directed towards the C-terminal region of Human IL21. Synthetic peptide located within the following region: ERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: interleukin 21
• Database Link:
  NP_001193935
  Entrez Gene 59067 Human
  UniProt ID Q9HBE4
• Background: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: CVID11; IL-21; Za11
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Goat: 86%; Sheep: 86%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway