Il3 (NM_010556) Mouse Recombinant Protein

CAT#: TP723224

Purified recombinant protein of Mouse interleukin 3 (Il3).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
• Tag: Tag Free
• Predicted MW: 15.1 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_034686
• Locus ID: 16187
• UniProt ID: P01586, Q5SX77
• Cytogenetics: 11 32.13 cM
• Refseq Size: 849
• Refseq ORF: 501
• Synonyms: BPA; Csfmu; HCGF; Il-3; MCGF; PSF
• Summary: This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. [UniProtKB/Swiss-Prot Function]