Il3 (NM_031513) Rat Recombinant Protein

CAT#: TP723233

Purified recombinant protein of Rat interleukin 3 (Il3).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
• Tag: Tag Free
• Predicted MW: 16.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 was determined by the dose-dependent stimulation of the proliferation of thymidine uptake by murine MC-9 cells is > 10 ng/ml, corresponding to a specific activity of >1.0 x 10^5 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113701
• Locus ID: 24495
• UniProt ID: P97688
• Cytogenetics: 10q22
• Refseq Size: 562
• Refseq ORF: 507
• Summary: cytokine that functions as a multi-lineage haemopoietic growth regulator [RGD, Feb 2006]