IL33 (NM_033439) Human Recombinant Protein

CAT#: TP723227

Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1.

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Tag: Tag Free
• Predicted MW: 17.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_254274
• Locus ID: 90865
• UniProt ID: O95760
• Cytogenetics: 9p24.1
• Refseq Size: 2718
• Refseq ORF: 810
• Synonyms: C9orf26; DVS27; IL1F11; NF-HEV; NFEHEV
• Summary: The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]
• Protein Families: Secreted Protein
• Protein Pathways: Cytosolic DNA-sensing pathway