IL33 (NM_033439) Human Recombinant Protein
CAT#: TP723227
Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
|
Tag | Tag Free |
Predicted MW | 17.9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_254274 |
Locus ID | 90865 |
UniProt ID | O95760 |
Cytogenetics | 9p24.1 |
Refseq Size | 2718 |
Refseq ORF | 810 |
Synonyms | C9orf26; DVS27; IL1F11; NF-HEV; NFEHEV |
Summary | The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015] |
Protein Families | Secreted Protein |
Protein Pathways | Cytosolic DNA-sensing pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409498 | IL33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409498 | Transient overexpression lysate of interleukin 33 (IL33) |
USD 325.00 |
|
TP720207 | Recombinant protein of human interleukin 33 (IL33) |
USD 300.00 |
|
TP720601 | Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1 |
USD 300.00 |
|
TP723790 | Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1 |
USD 275.00 |
|
TP760633 | Purified recombinant protein of Human interleukin 33 (IL33), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review