Il33 (NM_133775) Mouse Recombinant Protein

CAT#: TP723228

Purified recombinant protein of Mouse interleukin 33 (Il33), transcript variant 2.

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Tag: Tag Free
• Predicted MW: 17.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_598536
• Locus ID: 77125
• UniProt ID: Q8BVZ5
• Cytogenetics: 19 C1
• Refseq Size: 2534
• Refseq ORF: 798
• Synonyms: 9230117N10Rik; Il-33; Il1f11; NF-HEV
• Summary: In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. [UniProtKB/Swiss-Prot Function]