Il4 (NM_021283) Mouse Recombinant Protein

CAT#: TP723235

Purified recombinant protein of Mouse interleukin 4 (Il4), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
• Tag: Tag Free
• Predicted MW: 13.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 was determined by the dose-dependent proliferation of murine HT-2 cells is > 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067258
• Locus ID: 16189
• UniProt ID: P07750
• Cytogenetics: 11 31.97 cM
• Refseq Size: 605
• Refseq ORF: 420
• Synonyms: BSF-1; Il-4