IL7 (NM_000880) Human Recombinant Protein
CAT#: TP723243
Purified recombinant protein of Human interleukin 7 (IL7), transcript variant 1.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
|
Tag | Tag Free |
Predicted MW | 17.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 was determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000871 |
Locus ID | 3574 |
UniProt ID | P13232, A8K673 |
Cytogenetics | 8q21.13 |
Refseq Size | 2089 |
Refseq ORF | 531 |
Synonyms | IL-7 |
Summary | 'The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. IL7 plays an essential role in lymphoid cell survival, and in the maintenance of naive and memory T cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection can be a potent inducer of proinflammatory cytokines and chemokines which may defend against the infection, but may also mediate destructive lung injury. Elevated serum IL7 levels, together with several other circulating cytokines and chemokines, has been found to be associated with the severity of Coronavirus Disease 19 (COVID-19). [provided by RefSeq, Jul 2020]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424471 | IL7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424471 | Transient overexpression lysate of interleukin 7 (IL7) |
USD 396.00 |
|
TP720596 | Purified recombinant protein of Human interleukin 7 (IL7), transcript variant 1 |
USD 330.00 |
|
TP720815 | Purified recombinant protein of Human interleukin 7 (IL7), transcript variant 1 |
USD 330.00 |
|
TP723791 | Purified recombinant protein of Human interleukin 7 (IL7), transcript variant 1 |
USD 265.00 |
|
TP761214 | Purified recombinant protein of Human interleukin 7 (IL7), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review