Cxcl10 (NM_139089) Rat Recombinant Protein
CAT#: TP723254
Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 10 (Cxcl10).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
|
Tag | Tag Free |
Predicted MW | 8.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract hCXCR3/HEK293 cells using a concentration range of 10.0-50.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620789 |
Locus ID | 245920 |
UniProt ID | P48973 |
Cytogenetics | 14p22 |
Refseq Size | 1133 |
Refseq ORF | 294 |
Synonyms | IP-10; Scyb10 |
Summary | induces DNA synthesis, cell proliferation, and cell migration in vascular smooth muscle cells; may play a role in vascular remodeling [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP500291 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP723253 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10). |
USD 240.00 |
|
TP723727 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10 / IP10) |
USD 170.00 |
{0} Product Review(s)
Be the first one to submit a review