Cxcl10 (NM_139089) Rat Recombinant Protein

CAT#: TP723254

Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 10 (Cxcl10).

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP
• Tag: Tag Free
• Predicted MW: 8.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract hCXCR3/HEK293 cells using a concentration range of 10.0-50.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620789
• Locus ID: 245920
• UniProt ID: P48973
• Cytogenetics: 14p22
• Refseq Size: 1133
• Refseq ORF: 294
• Synonyms: IP-10; Scyb10
• Summary: induces DNA synthesis, cell proliferation, and cell migration in vascular smooth muscle cells; may play a role in vascular remodeling [RGD, Feb 2006]