Cxcl10 (NM_021274) Mouse Recombinant Protein

CAT#: TP723253

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
• Tag: Tag Free
• Predicted MW: 8.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay #1:Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067249
• Locus ID: 15945
• UniProt ID: P17515, Q548V9
• Cytogenetics: 5 46.57 cM
• Refseq Size: 1120
• Refseq ORF: 297
• Synonyms: C7; CRG-2; gIP-10; Ifi10; INP10; IP-10; IP10; mob-1; Scyb10
• Summary: In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development. [UniProtKB/Swiss-Prot Function]