CCL3L3 (NM_001001437) Human Recombinant Protein

CAT#: TP723265

Purified recombinant protein of Human chemokine (C-C motif) ligand 3-like 3 (CCL3L3).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
• Tag: Tag Free
• Predicted MW: 7.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001001437
• Locus ID: 414062
• UniProt ID: P16619
• Cytogenetics: 17q12
• Refseq Size: 780
• Refseq ORF: 279
• Synonyms: 464.2; D17S1718; G0S19-2; LD78; LD78BETA; SCYA3L; SCYA3L1
• Summary: This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. [provided by RefSeq, Apr 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction