Ccl2 (NM_031530) Rat Recombinant Protein

CAT#: TP723281

Purified recombinant protein of Rat chemokine (C-C motif) ligand 2 (Ccl2).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
• Tag: Tag Free
• Predicted MW: 14 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113718
• Locus ID: 24770
• UniProt ID: P14844
• Cytogenetics: 10q26
• Refseq Size: 780
• Refseq ORF: 444
• Synonyms: MCP-1; Scya2; Sigje
• Summary: a monocyte chemoattractant protein [RGD, Feb 2006]