Ccl2 (NM_011333) Mouse Recombinant Protein
CAT#: TP723257
Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2).
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
|
Tag | Tag Free |
Predicted MW | 13.8 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract Balb/C mouse spleen MNCs using a concentration range of 1.0-20.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_035463 |
Locus ID | 20296 |
UniProt ID | P10148, Q5SVU3 |
Cytogenetics | 11 49.82 cM |
Refseq Size | 806 |
Refseq ORF | 447 |
Synonyms | AI323594; HC11; JE; MCAF; MCP-1; MCP1; Scya2; Sigje; SMC-CF |
Summary | This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP526804 | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP723281 | Purified recombinant protein of Rat chemokine (C-C motif) ligand 2 (Ccl2). |
USD 240.00 |
|
TP723768 | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 2 (Ccl2 / MCP-1) |
USD 275.00 |
{0} Product Review(s)
Be the first one to submit a review