Cxcl9 (NM_008599) Mouse Recombinant Protein

CAT#: TP723302

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 9 (Cxcl9).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
• Tag: Tag Free
• Predicted MW: 12.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoacttract human lymphocytes using a concentration range of 0.1-1.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032625
• Locus ID: 17329
• UniProt ID: P18340
• Cytogenetics: 5 46.51 cM
• Refseq Size: 2905
• Refseq ORF: 381
• Synonyms: BB139920; CMK; crg-10; Mig; MuMIG; Scyb9
• Summary: May be a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. [UniProtKB/Swiss-Prot Function]