Ccl3 (NM_011337) Mouse Recombinant Protein

CAT#: TP723304

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 3 (Ccl3).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
• Tag: Tag Free
• Predicted MW: 7.8 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract murine balb/c splenocytes using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_035467
• Locus ID: 20302
• UniProt ID: P10855, Q5QNW0
• Cytogenetics: 11 51.04 cM
• Refseq Size: 804
• Refseq ORF: 279
• Synonyms: AI323804; G0S19-1; LD78alpha; MIP-1alpha; MIP1-(a); MIP1-alpha; Mip1a; Scya3
• Summary: Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils. [UniProtKB/Swiss-Prot Function]