Ccl3 (NM_013025) Rat Recombinant Protein
CAT#: TP723305
Purified recombinant protein of Rat chemokine (C-C motif) ligand 3 (Ccl3).
Other products for "Ccl3"
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
|
Tag | Tag Free |
Predicted MW | 7.8 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Assay#1: Determined by its ability to chemoattract rat peritoneal macrophages using a concentration of 50.0-100.0 ng/ml. Assay#2: Determined by its ability to chemoattract human blood monocytes using a concentration range of 10.0-100.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037157 |
Locus ID | 25542 |
UniProt ID | P50229 |
Cytogenetics | 10q26 |
Refseq Size | 755 |
Refseq ORF | 276 |
Synonyms | MIP-1a; Scya3 |
Summary | mediates monocyte and neutrophil chemotaxis; may play a role in the pathogenesis of acute lung injury [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.