Ccl3 (NM_013025) Rat Recombinant Protein

CAT#: TP723305

Purified recombinant protein of Rat chemokine (C-C motif) ligand 3 (Ccl3).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA
• Tag: Tag Free
• Predicted MW: 7.8 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay#1: Determined by its ability to chemoattract rat peritoneal macrophages using a concentration of 50.0-100.0 ng/ml. Assay#2: Determined by its ability to chemoattract human blood monocytes using a concentration range of 10.0-100.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037157
• Locus ID: 25542
• UniProt ID: P50229
• Cytogenetics: 10q26
• Refseq Size: 755
• Refseq ORF: 276
• Synonyms: MIP-1a; Scya3
• Summary: mediates monocyte and neutrophil chemotaxis; may play a role in the pathogenesis of acute lung injury [RGD, Feb 2006]